DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and prss59.1

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:224 Identity:69/224 - (30%)
Similarity:108/224 - (48%) Gaps:19/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKE------GERSIRAGSSLH 86
            ::|:||........|||.||. .|.||||||:.|:..:::||||.|.      ||.:|    .::
Zfish    19 DKIVGGYECQPNSQPWQASLN-SGYHFCGGSLVSEYWVVSAAHCYKSRVEVRLGEHNI----VIN 78

  Fly    87 DSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGR 151
            :.....:..|..|.:|.:|..::::|:.::|||.|.:.:..:|.:.|........:....:|||.
Zfish    79 EGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGN 143

  Fly   152 G-NFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM--GKGGCYGDSGGPLVFNGQLVG 213
            . :......:||.:||.|.....|...|...:.:...|||.:  ||..|.||||||:|.||:|.|
Zfish   144 TMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHG 208

  Fly   214 ITSRTGNIVCLGSS---LYASVARYRNWI 239
            |.|  ....|...:   :|..|..:..||
Zfish   209 IVS--WGYGCAEKNHPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 67/221 (30%)
Tryp_SPc 30..239 CDD:238113 67/220 (30%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 67/221 (30%)
Tryp_SPc 21..238 CDD:238113 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.