DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG31267

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:237 Identity:80/237 - (33%)
Similarity:120/237 - (50%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCI----KEGERSIRAGSSLH 86
            |.||:||...|:...|:.|||| .||.|||.|||.....:||||.|:    |...:.:....:..
  Fly    42 SSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHW 106

  Fly    87 DSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALAT-GWG 150
            .|.|.:..||..::|..||.....||:|::|..:...:.|..|.|.:|..:..|....|.. |:|
  Fly   107 GSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYG 171

  Fly   151 R----GNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDI---CA-GRMGKGGCYGDSGGPLV- 206
            .    |:|   ..|||.:::.......|...|| |..:.|:   || |::|.|.|:||:|||:| 
  Fly   172 STEIGGDF---SWQLQQLDVTYVAPEKCNATYG-GTPDLDVGHLCAVGKVGAGACHGDTGGPIVD 232

  Fly   207 FNGQLVGITSRTGN--IVC-LG-SSLYASVARYRNWILSAID 244
            ..|:|||:    ||  :.| .| ..::|.::.|.:||:|.|:
  Fly   233 SRGRLVGV----GNWGVPCGYGFPDVFARISFYYSWIISTIN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/228 (33%)
Tryp_SPc 30..239 CDD:238113 74/227 (33%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 75/228 (33%)
Tryp_SPc 45..268 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.