DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32834

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:259 Identity:91/259 - (35%)
Similarity:127/259 - (49%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSKCFHLLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTII 65
            |....|..|||.  |:.||... |:...|||||..:||.|.|:|..:...|...|.|:|.:...|
  Fly     1 MIWSVFLFLLAA--LLRPVRGD-LDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTI 62

  Fly    66 ITAAHCIKE-GERSIRAGSSL--HDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDS 127
            ||||.|::. |...:|.|:|.  :|..|.::.|...|.|||::....:|::|:|||..||..|::
  Fly    63 ITAASCVQSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEA 127

  Fly   128 IQTIPLAETDPPTSSSALATGWGR----GNFLIR-----PRQLQGVEILIRPLIVCKLKYG---- 179
            ||.|.:||.:|...|....:|||.    |::..|     |..||...:.:.....|....|    
  Fly   128 IQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFG 192

  Fly   180 ---NGVFNEDICAGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS-SLYASVARYRNWI 239
               ||:....:|. ..|.|||..|:|.|||.:||||||.|..|   |... .:||:|..:..||
  Fly   193 LWDNGISYLTLCT-HNGAGGCSYDTGAPLVIDGQLVGILSEGG---CTTKPDVYANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 80/229 (35%)
Tryp_SPc 30..239 CDD:238113 79/228 (35%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 80/229 (35%)
Tryp_SPc 27..255 CDD:238113 81/230 (35%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.