DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32808

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:121/240 - (50%) Gaps:32/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQ--YYGEHFCGGSIYSKTIIITAAHCIKEG---ERSIRAGSS-LHD 87
            :|:.|::....:.|:.|||:  ..|.|.||.::.:...::|||||::..   :..::.||. |..
  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93

  Fly    88 SGGVVVGVEAYIIHPQF---DKHNMENDVAVLKLSSPLSFSDSIQTIPLAETD--PPTSSSALAT 147
            :...|..|.|..:||.:   ||:  .||:|:|:|:..::.|..:|.:.|.|..  .|.::||:..
  Fly    94 NSSQVARVAAIFVHPGYEPEDKY--VNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLA 156

  Fly   148 GWG---RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAG--RMGKGGCYGDSGGPLVF 207
            |||   .|.  :..:.||.|::.:.....|..::...:.:..||||  ..|||.|.|||||||: 
  Fly   157 GWGLNATGG--VVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLL- 218

  Fly   208 NGQLVGITSRTGNI-----VCLG---SSLYASVARYRNWILSAID 244
               |:|..::.|.:     .|..   ..::..|:.|.:||:..::
  Fly   219 ---LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 66/233 (28%)
Tryp_SPc 30..239 CDD:238113 66/232 (28%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 66/233 (28%)
Tryp_SPc 30..258 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.