DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32755

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:141/292 - (48%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLIS------PVV---PVLLEPSERIIGGSSMDITDVPWQVSL-------QYYG-EHFC 55
            |::|.|..|:      |..   |.::.|  :|:||.::.|..||:|||:       ::|| .|.|
  Fly     9 LIVATHSGITQSQIGQPTATASPFVILP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVC 71

  Fly    56 GGSIYSKTIIITAAHC----------IKEGE-RSIRAGSSLHDSGGVVVGVEAYII-----HPQF 104
            ||::.|:.::.:||||          .::.| ..:.||||..|.....  .:.|::     |..:
  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRF--TQEYLVQRIVGHKDY 134

  Fly   105 DKHNMENDVAVLKLSSPLSF-SDSIQTIPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILI 168
            :...:|||:|:|.|:..:.: |..::.||||...|...::.|..|||:.....:...||...:.|
  Fly   135 NGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPI 199

  Fly   169 RPLIVCKLKYGNGVFNEDICAGRMGKGG---CYGDSGGPLVFNGQLVGITSRTGNIVCLG---SS 227
            ....:|::.|  .:....:|||.: :||   |.|||||||:.:|:|.||.|  ..:.|..   ..
  Fly   200 LNKELCQVIY--KLPASQMCAGFL-QGGIDACQGDSGGPLICDGRLAGIIS--WGVGCADPGYPG 259

  Fly   228 LYASVARYRNWILSAIDVLHF----QAPATNV 255
            :|.:|:.:..||..|...|.:    |.|..|:
  Fly   260 VYTNVSHFLKWIRRANASLDYSEYRQIPPLNL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 70/240 (29%)
Tryp_SPc 30..239 CDD:238113 70/239 (29%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/240 (29%)
Tryp_SPc 38..273 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.