DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG32376

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:244 Identity:75/244 - (30%)
Similarity:113/244 - (46%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPSE----RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI--KEGERSIRAG 82
            ||..|    ||:.|..:..|:.|:|.||.|.|...||..|.:|..|:||.||.  ...:.::|.|
  Fly    56 LEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVRVG 120

  Fly    83 SSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSA--- 144
            |.....||.:..|:..:....::.:.|.:|:|::||.||:.|...::.:.|    |.|.::.   
  Fly   121 SDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKL----PSTKTTKFPK 181

  Fly   145 --LATGWGRGNFLIRPRQLQGVEILIRPLIV-------CKLKY---GNGVFNEDICAGRMGKGGC 197
              :.:|||     |.....|.|:..:|.:.:       |:..|   |..::.:.|||.|..|..|
  Fly   182 KFVVSGWG-----ITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSC 241

  Fly   198 YGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAI 243
            .|||||||...|.|.||.|  ..|.|...:   :|.:..||..||...|
  Fly   242 SGDSGGPLTSRGVLYGIVS--WGIGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 69/229 (30%)
Tryp_SPc 30..239 CDD:238113 68/228 (30%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 69/229 (30%)
Tryp_SPc 66..287 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.