DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and CG6041

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:251 Identity:69/251 - (27%)
Similarity:117/251 - (46%) Gaps:29/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEPSERIIGGSSMDITDVPWQVSLQY-------YGE-HFCGGSIYSKTIIITAAHCI-------- 72
            :||  :|:||....|..|.:|||::.       ||. |.|||.:.|:.::.|||||.        
  Fly    31 IEP--KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKY 93

  Fly    73 -KEGERSIRAGSSLHDSG---GVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFS-DSIQTIP 132
             ..||..:..||:...|.   .::..::..|.|..::...:.||:|::.::..:.:: .::..:.
  Fly    94 RTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALA 158

  Fly   133 LAETDPPTSSSALATGWG--RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRMGKG 195
            |......|::..|.:|||  :.|.......||...:.|.....|::.| |.:....:|||.:..|
  Fly   159 LNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY-NSIPVSQVCAGYLSGG 222

  Fly   196 --GCYGDSGGPLVFNGQLVGITSRTGNIVCLG-SSLYASVARYRNWILSAIDVLHF 248
              .|.||||||:..||.|.||.|........| ..:|.:|:.|.:||:.....|::
  Fly   223 VDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYYYDWIVQKNSSLNY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 64/235 (27%)
Tryp_SPc 30..239 CDD:238113 64/234 (27%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 64/235 (27%)
Tryp_SPc 35..272 CDD:238113 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.