DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and GZMK

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:249 Identity:64/249 - (25%)
Similarity:110/249 - (44%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHC-----------IKEGERSIRAGS 83
            ||||..:.....|:..|:||.|.|.|||.:.....::|||||           :..|..|:    
Human    27 IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSL---- 87

  Fly    84 SLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPL-AETDPPTSSSALAT 147
            |.:::....:.::.:|...:.......||:.::||.:....:..::.:.: ::|...:.:....|
Human    88 SKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVT 152

  Fly   148 GWGRGN-FLIRPRQ-LQGVEILIRPLIVCKLK-YGNG---VFNEDICAG--RMGKGGCYGDSGGP 204
            |||..: ..:||.. |:.|.:.:....:|..: |.||   :..:.:|||  :..|..|.||||||
Human   153 GWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGP 217

  Fly   205 LVFNGQLVGITSRTGNIVC---LGSSLYASVA-RYRNWILSAIDVLHFQAPATN 254
            |:..|....|.|  |...|   ....:|..:. :|:.||.|     :...|.||
Human   218 LICKGVFHAIVS--GGHECGVATKPGIYTLLTKKYQTWIKS-----NLVPPHTN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 58/232 (25%)
Tryp_SPc 30..239 CDD:238113 58/232 (25%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 58/232 (25%)
Tryp_SPc 27..257 CDD:238113 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.