DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Elane

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:268 Identity:80/268 - (29%)
Similarity:121/268 - (45%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI 72
            :|||: ||:.|.:      :..|:||........|:.||||..|.||||.::.::..:::||||:
  Rat    18 MLLAL-LLVCPAL------ASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV 75

  Fly    73 K-EGERSIRAGSSLHD-----SGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQT- 130
            . ...:|::.....||     ....:..|:. |....||...:.||:.:::|:...:.:.::|. 
  Rat    76 NGRNFQSVQVVLGAHDLRRREPTRQIFSVQR-IFENGFDPSRLLNDIVIIQLNGSATINANVQVA 139

  Fly   131 -IPLAETDPPTSSSALATGWGR-GNFLIRPRQLQGVEILI------RPLIVCKLKYGNGVFNEDI 187
             :|.........:..:|.|||| |.....|..||.:.:.:      |.:.||.|           
  Rat   140 ELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTNLCRRRVNVCTL----------- 193

  Fly   188 CAGRMGKGGCYGDSGGPLVFNGQLVGITS--RTGNIVCLGSSLY----ASVARYRNWILSAIDVL 246
             ..|...|.|:||||||||.|..:.||.|  |.|   | ||..|    |.||.:.:||.|.|. .
  Rat   194 -VPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG---C-GSGFYPDAFAPVAEFADWINSIIR-S 252

  Fly   247 HFQAPATN 254
            |...|.||
  Rat   253 HDDRPLTN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 66/230 (29%)
Tryp_SPc 30..239 CDD:238113 66/229 (29%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/230 (29%)
Tryp_SPc 33..249 CDD:238113 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.