DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Klk11

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:225 Identity:67/225 - (29%)
Similarity:105/225 - (46%) Gaps:16/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEGERSIRAGSSLHDSGGVV- 92
            |||.|........||||:|.......||.::.:...::|||||.|.....:....:|..:.|.. 
  Rat    50 RIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQ 114

  Fly    93 --VGVEAYIIHPQFD----KHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGR 151
              :..|:: .||.|:    ..:..||:.::|:|||...:.:::.:.|:.......:|.|.:|||.
  Rat   115 RRMATESF-PHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGT 178

  Fly   152 GNF--LIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAG--RMGKGGCYGDSGGPLVFNGQLV 212
            .:.  |..|..|:...:.|.....|:..|...:.:..:||.  :.||..|.||||||||.||.|.
  Rat   179 TSSPQLRLPHSLRCANVSIIGHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQ 243

  Fly   213 GITSRTGNIVCLGS---SLYASVARYRNWI 239
            ||.| .|...|..:   .:|..|.:|.:||
  Rat   244 GIIS-WGQDPCAVTRKPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 65/223 (29%)
Tryp_SPc 30..239 CDD:238113 64/222 (29%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 65/223 (29%)
Tryp_SPc 51..275 CDD:238113 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.