DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Mcpt2

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:247 Identity:71/247 - (28%)
Similarity:108/247 - (43%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLEPS----ERIIGGSSMDITDVPWQVSLQYYGEH----FCGGSIYSKTIIITAAHCIKEGERSI 79
            ||.||    |.||||........|:...|....|.    .|||.:.|:..::||||| |..|.::
  Rat    10 LLLPSGAGAEEIIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHC-KGREITV 73

  Fly    80 RAGSSLHD-----SGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPP 139
            ..|:  ||     |....:.||..|||..::.....:|:.:|||...:..:.::..:||     |
  Rat    74 ILGA--HDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPL-----P 131

  Fly   140 TSSSAL-------ATGWGRGNFLIR-PRQ--LQGVEILIRPLIVCKLKYGNGVFNEDICAGRMG- 193
            :.|..:       |.|||:..  :| |..  |:.||:.|.....| :.|....:...:|.|... 
  Rat   132 SPSDFIHPGAMCWAAGWGKTG--VRDPTSYTLREVELRIMDEKAC-VDYRYYEYKFQVCVGSPTT 193

  Fly   194 -KGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSSLYASVARYRNWILSAID 244
             :....|||||||:..|...||.| .|:......:::..|:.|..||.:.|:
  Rat   194 LRAAFMGDSGGPLLCAGVAHGIVS-YGHPDAKPPAIFTRVSTYVPWINAVIN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 63/230 (27%)
Tryp_SPc 30..239 CDD:238113 63/229 (28%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 63/230 (27%)
Tryp_SPc 21..242 CDD:238113 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.