DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss38

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:120/262 - (45%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVHLLISPVV--PVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIK 73
            ::||.:|...  |.|   ..:::||........|||||:.|.|.|.|||||.:...::|||||..
  Rat    96 SLHLFLSSACGQPAL---HGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFA 157

  Fly    74 EGERSIRAGSSLHDSGGVVVG---------------VEAYIIHPQFDK-HNMENDVAVLKLSSPL 122
            ..:|.        .:..:.||               :...||||.|:. |.:..|||:::..|.:
  Rat   158 REKRL--------QTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAI 214

  Fly   123 SFSDSIQTIPLAETDPPTSS-SALATGWGRGNFLIRPRQLQGVEIL-----IRPLIVCKLKYG-- 179
            .|||.:..|.|..::...|. |...||||    ::.|:...|.::|     :.|...|:|.||  
  Rat   215 VFSDYVLPICLPSSNLNLSDLSCWTTGWG----MVSPQGETGKDLLEAQLPLIPKFQCQLLYGLT 275

  Fly   180 NGVFNEDICAG--RMGKGGCYGDSGGPLVFNGQ----LVGITS-RTGNIVCLGSSLYASVARYRN 237
            :.:..|.:|||  :..|..|.||||.|||....    .:||.| ..|....|...::|:|:.:.|
  Rat   276 SYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLN 340

  Fly   238 WI 239
            ||
  Rat   341 WI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 73/240 (30%)
Tryp_SPc 30..239 CDD:238113 73/239 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 75/239 (31%)
Tryp_SPc 116..342 CDD:214473 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.