DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss34

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:307 Identity:87/307 - (28%)
Similarity:134/307 - (43%) Gaps:63/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CFHLLLAVHLLI------SPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYG------EHFCGG 57
            |..:|..:.|.:      .|:.|...:....|:||..:..:..||||||::|.      ||.|||
  Rat     2 CLGMLWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGG 66

  Fly    58 SIYSKTIIITAAHCI--KEGERS---IRAGSSLHDSGGVVVGVEAYIIHPQF-DKHNMEN--DVA 114
            |:.....::|||||:  ||.|.|   ::.|.........::.|...|.||:| :|.:...  |:|
  Rat    67 SLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIA 131

  Fly   115 VLKLSSPLSFSDSIQTIPLAETDPPTSSSALAT-------GWG--RGNF-LIRPRQLQGVEILIR 169
            :|||.|.:..|:.:..:.|     |.:|..:::       |||  .|:. |..|..|:.|.:.|.
  Rat   132 LLKLDSTVVLSERVHPVSL-----PAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIV 191

  Fly   170 PLIVCKLKY--------GNGVFNED-ICAGRMGKGGCYGDSGGPLV--FNGQLVGITSRTGNIVC 223
            ....|:.||        ...:..:| :|||..|:..|..|||||||  :|...|.:...:..|.|
  Rat   192 GNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGC 256

  Fly   224 LG----SSLYASVARYRNWILSAI----------DVLHF--QAPATN 254
             |    ..:|..|..|.:||...:          |.:|.  ..|||:
  Rat   257 -GLPDFPGVYTRVMSYLSWIHGYVPKFPEPSMGPDRIHTPEDTPATH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 75/248 (30%)
Tryp_SPc 30..239 CDD:238113 75/247 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 76/248 (31%)
Tryp_SPc 33..275 CDD:214473 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.