DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss3b

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:75/249 - (30%)
Similarity:121/249 - (48%) Gaps:22/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIK 73
            |:.:..|.:.|...|.:..::|:||.:.....:|:||||. .|.||||||:.:...:::||||.|
  Rat     4 LIFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSLN-AGYHFCGGSLINSQWVVSAAHCYK 67

  Fly    74 E------GERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIP 132
            .      ||.:|    .:.:.|...:.....|.||.::.:..:||:.::||:||.:.:..:.|:.
  Rat    68 SRIQVRLGEHNI----DVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVSTVS 128

  Fly   133 LAETDPPTSSSALATGWGR-----GNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM 192
            |..:...:.:..|.:|||.     .|:   |..||.::..:.....||..|...:.:...|.|.:
  Rat   129 LPRSCGSSGTKCLVSGWGNTLSSGTNY---PSLLQCLDAPVLSDSSCKSSYPGKITSNMFCLGFL 190

  Fly   193 --GKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS-SLYASVARYRNWILSAI 243
              ||..|.||||||:|.||||.|:.|........|. .:|..|..|.|||...:
  Rat   191 EGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 69/223 (31%)
Tryp_SPc 30..239 CDD:238113 69/222 (31%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 69/223 (31%)
Tryp_SPc 25..243 CDD:238113 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.