DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and PRSS36

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:293 Identity:90/293 - (30%)
Similarity:128/293 - (43%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLLL-AVHLLISPVVPVLL-------------------EPSERIIGGSSMDITDVPWQVSLQYYG 51
            |||| .|.|:|||:.....                   |||.||:|||:......||||||.:.|
Human     4 HLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGG 68

  Fly    52 EHFCGGSIYSKTIIITAAHCI-------KEGERSIRAGSSLHDSGGVVVG-----VEAYIIHPQF 104
            .|.||||:.:.:.:::||||.       ...|.|:..|  :|...|.:.|     |.|.::...:
Human    69 GHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLG--VHSQDGPLDGAHTRAVAAIVVPANY 131

  Fly   105 DKHNMENDVAVLKLSSPLSFSDSIQTI--PLAETDPPTSSSALATGWG---RGNFLIRPRQLQGV 164
            .:..:..|:|:|:|:||.|...::..:  |.|.......::..|||||   ..:.|..|..||.|
Human   132 SQVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEV 196

  Fly   165 EILIRPLIVCKLKYGN-GVFNED-------ICAG--RMGKGGCYGDSGGPLVF--NGQ--LVGIT 215
            |:.:.....|:..|.. |.||..       :|||  ...:..|.||||||||.  .|:  ..|||
Human   197 ELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGIT 261

  Fly   216 S---------RTGNIVCLGSSLYASVARYRNWI 239
            |         |.|        ::.:||.|..||
Human   262 SFGFGCGRRNRPG--------VFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 76/249 (31%)
Tryp_SPc 30..239 CDD:238113 75/248 (30%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 76/249 (31%)
Tryp_SPc 47..289 CDD:238113 77/250 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.