DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Prss29

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:247 Identity:81/247 - (32%)
Similarity:114/247 - (46%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IIGGSSMDITDVPWQVSLQYY------GEHFCGGSIYSKTIIITAAHCIKEGERS-----IRAGS 83
            |:||.|......||||||:.|      ..|.|||||.....::||||||:|.:..     ||.|.
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGE 95

  Fly    84 SLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL--- 145
            :....|..::.|...||||.|....:.:|||:|:|:..:....:::.:.|     |:.|..:   
Mouse    96 AYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKL-----PSESLEVTKK 155

  Fly   146 ----ATGWG---RGNFLIRPRQLQGVEILIRPLIVCKLKYGNG----------VFNEDICAGRMG 193
                .||||   ....|..|.:||.|::.|....:|:..|.|.          :..:.:|||..|
Mouse   156 DVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQG 220

  Fly   194 KGGCYGDSGGPLVFN----GQLVGITSRTGNIVCLGS--SLYASVARYRNWI 239
            :..||||||||||.|    ..|||:.| .|....|..  .:||.|..:..||
Mouse   221 QDSCYGDSGGPLVCNVTGSWTLVGVVS-WGYGCALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 79/245 (32%)
Tryp_SPc 30..239 CDD:238113 79/245 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 81/247 (33%)
Tryp_SPc 31..271 CDD:214473 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.