DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and KLK11

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:268 Identity:69/268 - (25%)
Similarity:110/268 - (41%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEG- 75
            :.|::..:...|:....|||.|........|||.:|.......||.::.:...::|||||:|.. 
Human    36 LQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPWV 100

  Fly    76 --ERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNME---------------------------- 110
              .........|..|...:..:..||:|  ..:||::                            
Human   101 SLTSPTHVSPDLSSSNYCLSHLSRYIVH--LGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKD 163

  Fly   111 --NDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNF--LIRPRQLQGVEILIRPL 171
              ||:.::|::||:|.:.:::.:.|:.......:|.|.:|||..:.  |..|..|:...|.|...
Human   164 HRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEH 228

  Fly   172 IVCKLKYGNGVFNEDICAG--RMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCL---GSSLYAS 231
            ..|:..|...:.:..:||.  ..||..|.||||||||.|..|.||.| .|...|.   ...:|..
Human   229 QKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIIS-WGQDPCAITRKPGVYTK 292

  Fly   232 VARYRNWI 239
            |.:|.:||
Human   293 VCKYVDWI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 65/249 (26%)
Tryp_SPc 30..239 CDD:238113 64/248 (26%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 65/249 (26%)
Tryp_SPc 54..303 CDD:238113 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.