Sequence 1: | NP_608662.1 | Gene: | Send1 / 33407 | FlyBaseID: | FBgn0031406 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011524671.1 | Gene: | KLK11 / 11012 | HGNCID: | 6359 | Length: | 307 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 69/268 - (25%) |
---|---|---|---|
Similarity: | 110/268 - (41%) | Gaps: | 43/268 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCIKEG- 75
Fly 76 --ERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNME---------------------------- 110
Fly 111 --NDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNF--LIRPRQLQGVEILIRPL 171
Fly 172 IVCKLKYGNGVFNEDICAG--RMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCL---GSSLYAS 231
Fly 232 VARYRNWI 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Send1 | NP_608662.1 | Tryp_SPc | 29..239 | CDD:214473 | 65/249 (26%) |
Tryp_SPc | 30..239 | CDD:238113 | 64/248 (26%) | ||
KLK11 | XP_011524671.1 | Tryp_SPc | 53..300 | CDD:214473 | 65/249 (26%) |
Tryp_SPc | 54..303 | CDD:238113 | 66/250 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |