DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and LOC105945797

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:238 Identity:71/238 - (29%)
Similarity:108/238 - (45%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHC------IKEGERSIRAGSSLH 86
            ::|:||.:.....||:.|||. .|.||||||:.|...:::||||      ::.||..|:|     
 Frog    19 DKIVGGYTCAPNSVPYIVSLN-AGYHFCGGSLISSQWVVSAAHCFMNKIEVRLGEHDIKA----- 77

  Fly    87 DSGGVVVGVEAYIIHPQ------FDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSAL 145
                 ..|.|.:|...:      :....::||:.::||::|...:..:..:||........::.|
 Frog    78 -----TEGTEQFINSAKVIKNKGYSPRTLDNDIMLIKLATPAILNQYVSPVPLPSGCIEPRANCL 137

  Fly   146 ATGWGR-----GNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNEDICAGRM--GKGGCYGDSGG 203
            .:|||.     .|:   |..||.|...:.....|...|...:....||.|.:  ||..|.|||||
 Frog   138 ISGWGNTLSSGSNY---PNLLQCVSAPVLTADECNKAYPGEITQNMICVGFLEGGKDSCQGDSGG 199

  Fly   204 PLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILSAI 243
            |:|.||:|.||.|  ....|...:   :|..|..|..||.|.:
 Frog   200 PVVCNGELQGIVS--WGYGCAEKNYPGVYTKVCNYNAWIESTV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 68/231 (29%)
Tryp_SPc 30..239 CDD:238113 68/230 (30%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.