DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and Try5

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:85/255 - (33%)
Similarity:125/255 - (49%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI 72
            ||...|:..:...|:  :..::|:||.:.....||:||||. .|.||||||:.:...:::||||.
  Rat     4 LLFLAHVGAAVAFPI--DDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCY 65

  Fly    73 KE------GERSIRAGSSLHDSGGVVVGVEAY------IIHPQFDKHNMENDVAVLKLSSPLSFS 125
            |.      ||.:|          .|:.|.|.:      |.||.|:..|:.||:.::|||.|::.:
  Rat    66 KSRIQVRLGEHNI----------NVLEGNEQFVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLN 120

  Fly   126 DSIQTIPLAETDPPTSSSALATGWGRGNFLI----RPRQLQGVEILIRPLIVCKLKYGNGVFNED 186
            ..:.|:.|..:..|..:..|.:||  ||.|.    .|..||.::..:.|...|:..|...:.|..
  Rat   121 SRVATVALPSSCAPAGTQCLISGW--GNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNM 183

  Fly   187 ICAGRM--GKGGCYGDSGGPLVFNGQLVGITS-RTGNIVCLGSSLYASVARYRNWILSAI 243
            ||.|.:  ||..|.||||||:|.||||.||.| ..|..:.....:|..|..|.:||...|
  Rat   184 ICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 78/228 (34%)
Tryp_SPc 30..239 CDD:238113 78/227 (34%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 78/228 (34%)
Tryp_SPc 24..242 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.