DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send1 and gzm3.3

DIOPT Version :9

Sequence 1:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:262 Identity:73/262 - (27%)
Similarity:112/262 - (42%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FHLLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAH 70
            |.||||:.|...        ....||||........|:..|:|....|.|||.:.....::||||
Zfish     6 FLLLLAISLAGG--------MDSGIIGGKVAKAHSRPYMASIQINKHHTCGGMLIRDDYVLTAAH 62

  Fly    71 CIKEGERSIRA---------GSSLHDSGGVVVGVEAYIIHPQFDKHNMEN---DVAVLKLSSPLS 123
            |:..|..|.|.         ..|.|:.....:.|:.||.||.|.::..::   |:.:|||.:...
Zfish    63 CLNRGVYSGRGHLEVVLGAHNISKHEQNQQRIQVKKYIRHPMFQRNKEKDYSYDIMLLKLKNKAK 127

  Fly   124 FSDSIQTIPLAETDP--PTSSSALATGWGRGNFLIRPRQ------LQGVEILIRPLIVCKLKYGN 180
            .|..::.|.|.:.:.  |.:......|||    |.:|:.      |:.|.:.::....||..:..
Zfish   128 ISKFVKVISLPKKNGKIPANVKCSVAGWG----LTKPKAELASDVLEEVTLKLQFDFECKTMWQQ 188

  Fly   181 GVFNED--ICAGRMGKGG-CYGDSGGPLVFNGQLVGITSRT--GNIVCLGS---SLYASVARYRN 237
            . ||.:  ||:...||.. |.|||||||:.|.:...|.|.|  ||  |:..   .::..::.:..
Zfish   189 H-FNTERMICSVSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGN--CINKQYPQVFLKISYFLP 250

  Fly   238 WI 239
            ||
Zfish   251 WI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 65/237 (27%)
Tryp_SPc 30..239 CDD:238113 65/236 (28%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 67/238 (28%)
Tryp_SPc 22..252 CDD:214473 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.