DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss36

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:251 Identity:87/251 - (34%)
Similarity:119/251 - (47%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PE---RIVGG---HPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC-----VERPFDTLY 74
            ||   |||||   ||   ...|||.:|.....:|||..:.:...:::||||     ...|.|.| 
Mouse    42 PEPSSRIVGGSDAHP---GTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEL- 102

  Fly    75 SVRVG--SVWKNLGGQHAR-VAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL--ADS 134
            ||.:|  |....|.|.|.| ||.|...::| |:..|..|:|::||.........|||:.|  |..
Mouse   103 SVLLGVHSQDGPLEGAHMRSVATILIPDNY-STVELGADLALLRLASPAKLGPSVRPVCLPRASH 166

  Fly   135 APAAGTEASVSGWGEI--GILWLQPTSLLKTSVKILDPNVCKRSYQ---------YITKTMICAA 188
            ..|.||....:|||::  .:....|..|.:..:::|....|:..|.         .:...|:||.
Mouse   167 LFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAG 231

  Fly   189 --ALLKDSCHGDSGGPLV--SGGQ--LVGIVSYGIGCANPFFPGVYANVAELKPWI 238
              |..:|:|.||||||||  .||:  |.||.|:|.||.....|||:..||..:.||
Mouse   232 YPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 83/244 (34%)
Tryp_SPc 24..238 CDD:238113 82/243 (34%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 84/245 (34%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.