DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss55

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:121/259 - (46%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSP--------ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDK 57
            :|...|:.:||   ...|..|        .||:.|....:.|.|||.::..|:.:.||..|.|:.
Mouse    33 ILTECLLCIAS---SECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEW 94

  Fly    58 IIITAAHC--VERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTL 120
            .|:|.|||  .:....|...||||:...........|..|.:|:.: ....:.||||::.|...|
Mouse    95 WILTVAHCFYAQELSPTDLRVRVGTNDLTTSPVELEVTTIIRHKGF-KRLNMDNDIALLLLAKPL 158

  Fly   121 IFNAEVRPIQL-ADSAPAAGTEASVSGWGEIGILWLQ--PTSLLKTSVKILDPNVCKRSYQYITK 182
            .||....||.| ...||.:..|..|:|||.......:  .|.|:|..::|::...|.:.:..:|.
Mouse   159 TFNELTVPICLPLWPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMFPSLTT 223

  Fly   183 TMICAAALLK--DSCHGDSGGPLV------SGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            .|:||:...:  |:|.||||||||      |....|||:|:|..|....|||:|..:|:...||
Mouse   224 NMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 74/227 (33%)
Tryp_SPc 24..238 CDD:238113 73/226 (32%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.