DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk12

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:253 Identity:79/253 - (31%)
Similarity:117/253 - (46%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |:|:.:|.|..|  ..|:|..|...:.:..|||..|.:.:...||.|:...|.::|||||.::  
Mouse     6 LLLLCAVGLSQA--DREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHCRDK-- 66

  Fly    71 DTLYSVRVGS------VW-KNLGGQHARVAV--------IRKHEDYVSSTILFNDIAVIRLVDTL 120
               |.||:|.      .| :.|  :|...::        .:.||         :|:.::||...:
Mouse    67 ---YVVRLGEHSLTKLDWTEQL--RHTTFSITHPSYQGAYQNHE---------HDLRLLRLNRPI 117

  Fly   121 IFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKT 183
            .....|||:.|..|....|....|||||.....|.. |..|...::..:....|:..:. .:|:.
Mouse   118 HLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTEN 182

  Fly   184 MICAAALL-KDSCHGDSGGPLVSGGQLVGIVSYG-IG-CANPFFPGVYANVAELKPWI 238
            |:||.... ||:|.||||||||.||.|.|:||:| :| |.....||||..|.:...||
Mouse   183 MLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 71/234 (30%)
Tryp_SPc 24..238 CDD:238113 71/233 (30%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.