DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and LOC683849

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:230 Identity:87/230 - (37%)
Similarity:121/230 - (52%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNL- 85
            ::||||:....:.||:|.:| .|..:.||..:.:|:.:::||||    :.:...||:|....|: 
  Rat    22 DKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC----YKSRIQVRLGEHNINVL 81

  Fly    86 --GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWG 148
              ..|....|.|.||.::...| |.|||.:|:|...:..||.|..:.|..|...|||:..:||||
  Rat    82 EGNEQFVNAAKIIKHPNFDRKT-LNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWG 145

  Fly   149 ---EIGILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL--KDSCHGDSGGPLVSGG 207
               ..|:  .:|..|......:|....|:.||. .||..|:||..|.  ||||.||||||:|..|
  Rat   146 NTLSFGV--NEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNG 208

  Fly   208 QLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            :|.||||:|.|||.|..||||..|.....||.:.|
  Rat   209 ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIEDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 84/223 (38%)
Tryp_SPc 24..238 CDD:238113 84/222 (38%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 84/223 (38%)
Tryp_SPc 24..242 CDD:238113 86/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.