DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:124/249 - (49%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            |.:|..:.:...:......::||||:....:.:|:|.:| .|..:.||..:.:.:.:::||||  
Mouse     4 LIFLAFLGAAVALPLDDDDDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWVVSAAHC-- 65

  Fly    68 RPFDTLYSVRVGSVWKNL-----GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVR 127
              :.:...||:|.  .|:     |.|....|.|.:|.:|.::| ..|||.:|:|......|:.|.
Mouse    66 --YKSRIQVRLGE--HNIDALEGGEQFIDAAKIIRHPNYNANT-YNNDIMLIKLKTAATLNSRVS 125

  Fly   128 PIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLK-TSVKILDPNVCKRSYQ-YITKTMICAAAL 190
            .:.|..|.|:|||...|||||..........|||: ....:|..:.|..||. .||..|.|...|
Mouse   126 TVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGKITSNMFCLGFL 190

  Fly   191 L--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            .  ||||.||||||:|..|||.|:||:|.|||....||||..|.:...||...|
Mouse   191 EGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/223 (36%)
Tryp_SPc 24..238 CDD:238113 81/222 (36%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 81/223 (36%)
Tryp_SPc 25..243 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.