DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and prss1

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:246 Identity:84/246 - (34%)
Similarity:125/246 - (50%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |.|.|.......|...::||||:....:.||:|.:| .|..:.||..:.|:..:::||||    :
Zfish     7 LALFAVAYAAPLGDDDDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVSAAHC----Y 66

  Fly    71 DTLYSVRVGSVWKNLG-----GQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQ 130
            .:...||:|.  .|:.     .|......:.:|..|.|:| |.||:.:|:|..:...|:.|:.:.
Zfish    67 KSRVQVRLGE--HNIDVTEGTEQFINSEKVIRHPSYNSNT-LDNDVMLIKLSSSAQINSYVKTVS 128

  Fly   131 LADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL-- 191
            |..|..::||...:||||.:...... |:.|:..:..||..:.|:.:|. .|:..|.||..:.  
Zfish   129 LPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQISSNMFCAGFMEGG 193

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            ||||.||||||:|...||.||||:|.|||....|||||.|.....||.|.:
Zfish   194 KDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRNTM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 77/223 (35%)
Tryp_SPc 24..238 CDD:238113 77/222 (35%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 77/223 (35%)
Tryp_SPc 25..243 CDD:238113 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.