DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG17242

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:254 Identity:89/254 - (35%)
Similarity:134/254 - (52%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            |||..::|:.|:..|:|..   :.:|     |.:.||||::..::|:.||.||||:.||:|.|.|
  Fly     1 MLLKGILLLVSIAQIAADF---KSIG-----IEQAPWQASVQINDKHHCGGVIYSEDIILTIAEC 57

  Fly    66 VERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILF---NDIAVIRLVDTLIFNAEVR 127
            |.:......||||||..:|.||...:|..:|..       :|.   :|:|:::|...|..:..:|
  Fly    58 VRKARLEFISVRVGSAQENAGGTVLKVEKMRLQ-------VLGLRPSDVAILQLRSPLYLDGGIR 115

  Fly   128 PIQLADSAPAAGTEASVSGWGEIGILWLQPTS--LLKTSVKILDPNVCKRSYQYITKTM----IC 186
            .|.||......||.|||||||::..  :.|:|  ||:..|||.|..:|..:.....:.|    ||
  Fly   116 AIPLATIPLVPGTNASVSGWGQLSA--MNPSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEIC 178

  Fly   187 AAAL--LKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIE 243
            ||..  :..:|.|..|||||:..:|.||:|:...|.......||||:|..|.||.:.::
  Fly   179 AAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 80/225 (36%)
Tryp_SPc 24..238 CDD:238113 80/224 (36%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 81/219 (37%)
Tryp_SPc 24..232 CDD:214473 79/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.