DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG34458

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:241 Identity:78/241 - (32%)
Similarity:118/241 - (48%) Gaps:10/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLVASVTLISAG---SSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVER 68
            :|:.:||.:.:.   :...||:||......:.|.|.:|..:.::.||..:.||.:|:|||||...
  Fly    12 ILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMG 76

  Fly    69 PFDTLYSVRVGSVWKNLG-GQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLA 132
            .........||:...:.| ||...:|....|..|...:..| |:::|:|...:.....|:.||||
  Fly    77 QNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDF-DMSLIKLSSPVPMGGAVQTIQLA 140

  Fly   133 DSAP--AAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVC-KRSYQYITKTMICAA--ALLK 192
            ||..  ||.|.|.:||:|.|......|..|....|::...:.| .::...:|..|:||.  :...
  Fly   141 DSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPSGQV 205

  Fly   193 DSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            .||.|||||||...|:|.|:||:|.||.....|.:|..|..|:.||
  Fly   206 SSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 73/220 (33%)
Tryp_SPc 24..238 CDD:238113 72/219 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 73/220 (33%)
Tryp_SPc 32..254 CDD:238113 74/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.