DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and PRTN3

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:256 Identity:72/256 - (28%)
Similarity:110/256 - (42%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMY---SEKYICGAVIYSDKIIITAAHCVE 67
            |..|....|:|..:....|||||.......|:.|:|..   ...:.||..:.....::|||||:.
Human    10 LASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLR 74

  Fly    68 RPFDTLYSVRVGSVWKNL-----GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVR 127
            .....|.:|.:|:  .|:     ..||..||.:..: :|.:...| ||:.:|:|......:|.|.
Human    75 DIPQRLVNVVLGA--HNVRTQEPTQQHFSVAQVFLN-NYDAENKL-NDVLLIQLSSPANLSASVA 135

  Fly   128 PIQL--ADSAPAAGTEASVSGWGEIG-----ILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMI 185
            .:||  .|.....||:....|||.:|     ...||..::...:......|:|  ::....|..|
Human   136 TVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNIC--TFVPRRKAGI 198

  Fly   186 CAAALLKDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILNAIEQL 245
                     |.|||||||:..|.:.||.|:.| |||...||..:..||....||.:.:.::
Human   199 ---------CFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 66/230 (29%)
Tryp_SPc 24..238 CDD:238113 66/229 (29%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.