DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and KLK10

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:236 Identity:65/236 - (27%)
Similarity:99/236 - (41%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHAR 91
            |.|......|||.:|.....:.|..|:.....::|||||..:|           :|..:|..|..
Human    49 GSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKP-----------LWARVGDDHLL 102

  Fly    92 V-----------AVIRKHEDYVSSTIL-----FNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGT 140
            :           :|:.......|..||     .:|:.:::|...::....||.:||.......|.
Human   103 LLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGD 167

  Fly   141 EASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAA-LLKDSCHGDSGGP 202
            :..|:|||......:: ...|..:|:.||.|..|:..|. .:|..||||.. ..:|.|..|||||
Human   168 QCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGP 232

  Fly   203 LVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILNAI 242
            ||....|.||:|:|: .|.:...|.||..:.:...||...|
Human   233 LVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 62/230 (27%)
Tryp_SPc 24..238 CDD:238113 62/230 (27%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 64/233 (27%)
Tryp_SPc 49..269 CDD:214473 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.