DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk11

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:132/249 - (53%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            |:|. |:.:|.||....|.:  ||:.|:.......|||.||....:.:|||.:.:.|.::|||||
Mouse    28 MILR-LIALALVTGHVGGET--RIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC 89

  Fly    66 VERPFDTLYSVRVG--SVWKNLGGQHARVAVIR-KHEDYVSS---TILFNDIAVIRLVDTLIFNA 124
             .:|.   |.:.:|  ::.|..|.:..|:|... .|.|:.:|   ....|||.::::...:.|..
Mouse    90 -RKPH---YVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTR 150

  Fly   125 EVRPIQLADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMICA 187
            .|:|:.|:....||||...:||||......|: |.||...:|.|::...|:::|. .||.||:||
Mouse   151 AVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKAYPGNITDTMLCA 215

  Fly   188 AALL--KDSCHGDSGGPLVSGGQLVGIVSYGIG-CANPFFPGVYANVAELKPWI 238
            :...  ||||.||||||||..|.|.||:|:|.. ||....||||..|.:...||
Mouse   216 SVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/225 (36%)
Tryp_SPc 24..238 CDD:238113 80/224 (36%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 81/225 (36%)
Tryp_SPc 48..272 CDD:238113 82/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.