DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and PRSS1

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:246 Identity:88/246 - (35%)
Similarity:120/246 - (48%) Gaps:18/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |..||: .|.:.....::||||:....:.||:|.:| .|..:.||..:.:::.:::|.||    :
Human   232 LTFVAA-ALAAPFDDDDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSAGHC----Y 290

  Fly    71 DTLYSVRVGSVWKNL-----GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQ 130
            .:...||:|.  .|:     ..|....|.|.:|..|...| |.|||.:|:|....:.||.|..|.
Human   291 KSRIQVRLGE--HNIEVLEGNEQFINAAKIIRHPQYDRKT-LNNDIMLIKLSSRAVINARVSTIS 352

  Fly   131 LADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL-- 191
            |..:.||.||:..:||||........ |..|......:|....|:.||. .||..|.|...|.  
Human   353 LPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGG 417

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            ||||.||||||:|..|||.|:||:|.|||....||||..|.....||.|.|
Human   418 KDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 80/223 (36%)
Tryp_SPc 24..238 CDD:238113 80/222 (36%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 80/223 (36%)
Tryp_SPc 249..467 CDD:238113 82/225 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8646
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.