DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and KLK15

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:271 Identity:89/271 - (32%)
Similarity:124/271 - (45%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVASVTLIS-AGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVER 68
            ||:|..|..|.| |....::::.|........|||.||....::.|||.:.|...:::||||..|
Human     2 WLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSR 66

  Fly    69 PFDTLYSVRVG--SVWKNLGGQHARVA--VI-------RKHEDYVSSTILFNDIAVIRLVDTLIF 122
                ...||:|  ::.|..|.:..|..  ||       |.|.         |||.::|||.....
Human    67 ----FMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHR---------NDIMLLRLVQPARL 118

  Fly   123 NAEVRPIQLADSAPAAGTEASVSGWG---------------EIGILWLQPTSLLKTSVKILDPNV 172
            |.:|||..|....|..|....|||||               ::.:    |.:|...::.|:....
Human   119 NPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSL----PDTLHCANISIISDTS 179

  Fly   173 CKRSYQ-YITKTMICAAALLK--DSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAE 233
            |.:||. .:|.||:||.|..:  :||.||||||||.||.|.||||:| :.|.|...||||..|..
Human   180 CDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCH 244

  Fly   234 LKPWILNAIEQ 244
            ...||...:::
Human   245 YLEWIRETMKR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 80/244 (33%)
Tryp_SPc 24..238 CDD:238113 80/243 (33%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8646
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.