DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and prss1

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:249 Identity:85/249 - (34%)
Similarity:128/249 - (51%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            :.:|:::..:....|....::||||.....:.||:|.:| .:..:.||..:.:.:.:::||||  
 Frog     1 MKFLIVLVLLGAAVAFEDDDKIVGGFTCTKNAVPYQVSL-NAGYHFCGGSLINSQWVVSAAHC-- 62

  Fly    68 RPFDTLYSVRVG--SVWKNLG-GQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
              :.:...||:|  ::..|.| .|......:.||..| :|..|.|||.:|:|..|...::.::.:
 Frog    63 --YKSRIQVRLGEHNIAVNEGTEQFIESQKVIKHPSY-NSRNLDNDIMLIKLSTTARLSSNIQSV 124

  Fly   130 QLADSAPAAGTEASVSGWGEI---GILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAAL 190
            .|..:..:|||...:||||..   |..:  |..|...:..||..:.|..||. .||..|.||..|
 Frog   125 PLPSACASAGTNCLISGWGNTLSSGTNY--PDLLQCLNAPILTASECSNSYPGEITNNMFCAGFL 187

  Fly   191 L--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            .  ||||.||||||:|..|||.|:||:|.|||...:||||..|.....||.|.|
 Frog   188 AGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/223 (35%)
Tryp_SPc 24..238 CDD:238113 79/222 (36%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.