DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Elane

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:237 Identity:74/237 - (31%)
Similarity:108/237 - (45%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQ 88
            ||||.|......|:.|:|.....:.|||.:.:...:::|||||.       .:...||...||..
Mouse    29 IVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVN-------GLNFRSVQVVLGAH 86

  Fly    89 HAR--------VAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAG------ 139
            ..|        .:|.|..|:....:.|.|||.:|:|..:...||.|:..||    ||.|      
Mouse    87 DLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQL----PAQGQGVGDR 147

  Fly   140 TEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMICAAALLKDS--CHGDSGGP 202
            |.....|||.:|.....|:.|.:.:|.:: .|:|:|      :..:|.....:.:  |.||||||
Mouse   148 TPCLAMGWGRLGTNRPSPSVLQELNVTVV-TNMCRR------RVNVCTLVPRRQAGICFGDSGGP 205

  Fly   203 LVSGGQLVGIVSY--GIGCANPFFPGVYANVAELKPWILNAI 242
            ||....:.||.|:  | ||.:..:|..:|.|||...|| |:|
Mouse   206 LVCNNLVQGIDSFIRG-GCGSGLYPDAFAPVAEFADWI-NSI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/231 (30%)
Tryp_SPc 24..238 CDD:238113 70/231 (30%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/231 (30%)
Tryp_SPc 29..245 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.