DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss53

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:229 Identity:62/229 - (27%)
Similarity:97/229 - (42%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC-VERPFDTLYSVRVGSVWKNLGGQHARVAVI 95
            :|:.||.|.|.:..|..||..:.|:.:::||||| :.|.....:||.:|:     |.:...:..:
  Rat   348 LSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGA-----GPEEWGLKQL 407

  Fly    96 RKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL--ADSAPAAGTEASVSGW-----GEIGIL 153
            ..|..|.... ..:|:|.:.|...:.....:||:.|  ||.....|..    ||     .|.|| 
  Rat   408 ILHGAYTHPE-GGHDVAFLLLAQPVTLGPGLRPLCLPYADHRLPDGEH----GWVLGLTREAGI- 466

  Fly   154 WLQPTSLLKTSVKILDPNVCKRSYQYITKT-------MICAAALLK-DSCHGDSGGPLVSGGQ-- 208
             ..|.::   .|.:|.|..|.|.:.....|       |||...:.: ..|.|.||.|||...:  
  Rat   467 -NHPHTV---PVTVLGPMACSRQHAASGSTGVPILPGMICTTVVGEPPHCEGLSGAPLVHEIRGT 527

  Fly   209 --LVGIVSYGIGCANPFFPGVYANVAELKPWILN 240
              |.|:.|:|..|.....|.|:|.::..:.|:.|
  Rat   528 WFLAGLHSFGDTCQGSAKPAVFAALSAYEDWVSN 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 60/225 (27%)
Tryp_SPc 24..238 CDD:238113 60/225 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 61/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.