DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and betaTry

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:252 Identity:112/252 - (44%)
Similarity:155/252 - (61%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLHWLVLVASVTLISAGSSPE--------RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKI 58
            :|.:|:|:::|.....|:.||        |||||....||..|||.:|..|..:.||..|||.::
  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARV 65

  Fly    59 IITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFN 123
            |:|||||::....:...:|.||.:.:.||..|:|:..:.||.|.::|:: |||||:.|..:|.|:
  Fly    66 IVTAAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMV-NDIAVLHLSSSLSFS 129

  Fly   124 AEVRPIQLADSAPAAGTEASVSGWG-EIGILWLQPTSLLKTSVKILDPNVC-KRSYQY---ITKT 183
            :.::.|.||.|.||.|..||||||| |.......|:.|...:|.|:..:.| ..||.|   |..:
  Fly   130 STIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSS 194

  Fly   184 MICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILN 240
            ||||.|..||||.|||||||||||.|||:||:|.|||...:|||||:||.|:.|::|
  Fly   195 MICAFASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVIN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 103/219 (47%)
Tryp_SPc 24..238 CDD:238113 102/218 (47%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 103/219 (47%)
Tryp_SPc 31..252 CDD:238113 104/222 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443199
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.