DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and KLK12

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:242 Identity:78/242 - (32%)
Similarity:119/242 - (49%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            :.|:..|..:|..::| :|..|.....:..|||..|.......||.|:...:.::|||||    .
Human     5 IFLLLCVLGLSQAATP-KIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC----S 64

  Fly    71 DTLYSVRVGS------VWKNLGGQHARVAVIRKHEDYV-SSTILFNDIAVIRLVDTLIFNAEVRP 128
            .:.|.||:|.      .|.. ..:|:..:|  .|..|: :||...:|:.::||...:...:.|:|
Human    65 GSRYWVRLGEHSLSQLDWTE-QIRHSGFSV--THPGYLGASTSHEHDLRLLRLRLPVRVTSSVQP 126

  Fly   129 IQLADSAPAAGTEASVSGWGEIGILWLQPTS----LLK-TSVKILDPNVCKRSYQ-YITKTMICA 187
            :.|.:....||||..|||||    :...|.:    ||: .::.|:....|...|. .||..|:||
Human   127 LPLPNDCATAGTECHVSGWG----ITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCA 187

  Fly   188 AALL-KDSCHGDSGGPLVSGGQLVGIVSYG-IG-CANPFFPGVYANV 231
            ..:. :|:|.||||||||.||.|.|:||:| :| |.....||||..:
Human   188 GGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 74/225 (33%)
Tryp_SPc 24..238 CDD:238113 74/224 (33%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 74/225 (33%)
Tryp_SPc 22..236 CDD:238113 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.