DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and KLK14

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:249 Identity:92/249 - (36%)
Similarity:133/249 - (53%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYS--EKYICGAVIYSDKIIITAAH 64
            ||...:.|.::.:..:.....:|:|||....|..||||||:..  .:::||..:.|.:.:|||||
Human     3 LLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAH 67

  Fly    65 CVERPFDTLYSVRVGSVWKNLGGQHARVAVIR-----KHEDYVSSTILFNDIAVIRLVDTLIFNA 124
            | .||   :..|.:|.  .||....|...|:|     .|.:|.|.| ..||:.:::|........
Human    68 C-GRP---ILQVALGK--HNLRRWEATQQVLRVVRQVTHPNYNSRT-HDNDLMLLQLQQPARIGR 125

  Fly   125 EVRPIQLADSAPAAGTEASVSGWGEIGI-LWLQPTSLLKTSVKILDPNVCKRSY-QYITKTMICA 187
            .||||::..:..:.||...|||||.|.. :...|.||...::.|....||:::| :.||..|:||
Human   126 AVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCA 190

  Fly   188 AALL--KDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWI 238
            ....  ||||.||||||||..|||.|:||:|: .||.|.:||||.|:.:.:.||
Human   191 GVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 87/226 (38%)
Tryp_SPc 24..238 CDD:238113 87/225 (39%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 89/227 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8646
orthoMCL 1 0.900 - - OOG6_128159
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.