DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG34130

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:235 Identity:58/235 - (24%)
Similarity:104/235 - (44%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRV-----GSVW 82
            |..|||     .|||...::....::|||...|....:|:|:|:......:.|:.|     .|..
  Fly    48 RTSGGH-----AVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQ 107

  Fly    83 KNLGGQH------ARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTE 141
            .|....|      .|..::.|...:..:   |.|:|||.|.:.|..|.. ..:.|..:..::...
  Fly   108 DNQLDSHDPPNALIRNIIVSKDWHWPGT---FMDVAVIELTNRLRGNRN-NYVTLCTNPLSSYKS 168

  Fly   142 ASVSGWGEIGILWLQPTSLLKT-SVKILDPNVCKRSYQ--YITKTMICAAALLKDS-CHGDSGGP 202
            .||..:|      ..|...::| .:::|:..:|..:|.  .:.:|:.||....:.: |...:|.|
  Fly   169 LSVVSYG------AGPAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSADCMFSAGCP 227

  Fly   203 LVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            :.:|.||.|||::...|.....||::.::.::|.:||.||
  Fly   228 VTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILKAI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 54/229 (24%)
Tryp_SPc 24..238 CDD:238113 53/228 (23%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 51/224 (23%)
Tryp_SPc 53..256 CDD:304450 50/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.