DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:82/271 - (30%)
Similarity:118/271 - (43%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VASVTLISAGS---SPE-------RIVGGHPVLISEVPWQAALMYS--EKYICGAVIYSDKIIIT 61
            ||:.|.:.|.:   :|.       ||..|:|....:||:...|::|  ..:.||..|..:..::|
  Fly    11 VAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLT 75

  Fly    62 AAHCVERPFDTLY----SVRVG---SVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL--V 117
            ||||.........    |:|..   :.|...|.       |.:|..|.|.. |.|||::||.  |
  Fly    76 AAHCTNGASGVTINYGASIRTQPQYTHWVGSGD-------IIQHHHYNSGN-LHNDISLIRTPHV 132

  Fly   118 DTLIFNAEVRPIQLADSAPA--------AGTEASVSGWGEIGIL-------WLQPTSLLKTSVKI 167
            |   |.:.|..::|    |:        ||..|..||||  |..       |||     ...|:|
  Fly   133 D---FWSLVNKVEL----PSYNDRYQDYAGWWAVASGWG--GTYDGSPLPDWLQ-----SVDVQI 183

  Fly   168 LDPNVCKRSYQYITKTMICA-AALLKDSCHGDSGGPLVS--GGQLVGIVSYG--IGCANPFFPGV 227
            :..:.|.|::. :...|||. ....|.:|.||||||||:  |.:|||:.|:|  .||.:. .|.|
  Fly   184 ISQSDCSRTWS-LHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSG-APAV 246

  Fly   228 YANVAELKPWI 238
            ::.|.....||
  Fly   247 FSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 75/245 (31%)
Tryp_SPc 24..238 CDD:238113 74/244 (30%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.