DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG7829

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:242 Identity:84/242 - (34%)
Similarity:129/242 - (53%) Gaps:7/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHW-LVLVASVTLISAGSSPE-RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            |.| |:|:.:...:|..|.|: |||||.|..|:.:|:..::.....:.||..|.::..|:||.||
  Fly     5 LWWKLLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHC 69

  Fly    66 VERPFDTLYSVRVGSVWK-NLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
            :......|..|:||...: ...|:...||.::.||::...|:.: ||.:|||...|..:.:|:.|
  Fly    70 LNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDY-DIGIIRLTKNLTLSRKVKAI 133

  Fly   130 QLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSY-QYITKTMICAAALL-- 191
            .:.....|.||.|:::|||...:......||....|.|::...|:... :.:|..|:||..|.  
  Fly   134 PINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGG 198

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            .|:|..||||||....|||||||:|:|||....||||:.:..|.||:
  Fly   199 TDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 76/218 (35%)
Tryp_SPc 24..238 CDD:238113 75/217 (35%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 75/217 (35%)
Tryp_SPc 28..248 CDD:238113 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443385
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.