DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and intr

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:221 Identity:52/221 - (23%)
Similarity:94/221 - (42%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LMYSEKYICGAVIYSDKIIITAAHCVER----PFDTLYSV-----RVGSVWKNLGGQHARVAVIR 96
            ::|..|.||...:.|.::::|:|.|..|    |....|.:     |:.||...:.|         
  Fly   105 ILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANLITG--------- 160

  Fly    97 KHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLL 161
                      ...|:|:: |:...:.:..|.||.|.:|........:         :::....|.
  Fly   161 ----------AIEDMALL-LLHAPLEDPFVHPIDLCESPLRRNDNVT---------MYMSQQHLR 205

  Fly   162 KTSVKILDPNVCKRSY-----QYITKTMICA--AALLKDSCHGDSGGPLVSGGQLVGIVSYGIGC 219
            ....|::..:.|||||     .:||:||:||  :..|.| |....|..|:...:|.|:..||..|
  Fly   206 FLRTKLIPNSNCKRSYAQDENAFITQTMLCALNSNRLVD-CQTAKGDVLLHQDRLCGVDIYGQHC 269

  Fly   220 ANPFFPG-VYANVAELKPWILNAIEQ 244
            ::....| :||:|.:.:..:::.||:
  Fly   270 SDGGVNGELYADVFKARTELMHLIER 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 50/213 (23%)
Tryp_SPc 24..238 CDD:238113 50/213 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.