DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG34129

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:229 Identity:59/229 - (25%)
Similarity:108/229 - (47%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WQAALMYSE-KYICGAVIYSDKIIITAAHCVERPFDTLYSVRV-GSVWKNLGGQ-HARVAVIRKH 98
            |...::..: .:.|||..|:..::||:|:|:....::|....| |:.:.....: :|.:..|:..
  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFP 119

  Fly    99 EDYVSSTILFNDIAVIRLVDTL---------IFNAEVRP-IQLADSAPAAGTEASVSGWG----E 149
            |.::... |:.|:||:||.|.:         :.:.:|:| :|:.           |.|||    |
  Fly   120 EKFIYQK-LYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMV-----------VFGWGFDNTE 172

  Fly   150 IGILWLQPTSLLKTSVKILDPNVCKRSYQ--YITKTMICAAALLK-DSCHGDSGGPLVSGGQLVG 211
            :.|....|.::..|.:.|.:   |::.::  .|..|.|||..... ..|..|.|.||:.|.:|.|
  Fly   173 VEIPSSDPRNVTVTIISIKE---CRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCG 234

  Fly   212 IVSYGIGCANPFFPGVYANVAELKPWILNAIEQL 245
            :||:|..|.:...||:|.|:..:|.:|....|.:
  Fly   235 VVSFGSHCIDTSRPGMYTNIRRVKRFITETEESI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 57/220 (26%)
Tryp_SPc 24..238 CDD:238113 57/220 (26%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/220 (26%)
Tryp_SPc 55..261 CDD:304450 57/220 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.