DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG15498

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:134 Identity:27/134 - (20%)
Similarity:53/134 - (39%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVI--RLV---------DTLIFN--AEVR 127
            |:||:..:....:..|::.::|..:  |..:|.:....:  |..         |.|.|.  .::|
  Fly     6 VKVGNWLETALSEEMRMSEMKKRRE--SGNLLLDRTRAVYDRFYQGTVLGPPQDVLAFGVVVQIR 68

  Fly   128 PI-------QLADS-------APAAGTEASVSGWGEIGILWLQPT--SLLKTSVKILDPNVCKRS 176
            |:       |::|.       ....|...:.....|:..|.:.|:  ..|:.|.:|:.||...|:
  Fly    69 PVKIGVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPRPALRNSFRIVSPNEDDRT 133

  Fly   177 YQYI 180
            .||:
  Fly   134 GQYL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 27/134 (20%)
Tryp_SPc 24..238 CDD:238113 27/134 (20%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.