DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG7432

DIOPT Version :10

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:59 Identity:12/59 - (20%)
Similarity:23/59 - (38%) Gaps:15/59 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSPRQMQMVSTAQAAHSRLLWSGCSHQAPVRHFSTEKDTARVEEPTENEKKLTVEVEEL 65
            :.||...|              |...:|.:|.|:.... .|..||..:.:.::.::||:
  Fly    50 YKPRSFAM--------------GFGKRAAMRSFNMGFG-KRSAEPQIDYEDMSADLEEI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 9/43 (21%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 475..718 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.