DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG17475

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:114/257 - (44%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAAL--MYSEKYICGAVIYSDKIIITAAHC 65
            |.|:.....|..      ..|::.|..|.:.|..:|.:|  ||. .:|||..|..::.::|||||
  Fly    35 LEWISKAEGVNF------QNRVINGEDVQLGEAKYQISLQGMYG-GHICGGCIIDERHVLTAAHC 92

  Fly    66 VERPFDTLYSVRVGSVWKNLGGQHAR---VAVIRKH--------EDYVSSTILFNDIAVIRLVDT 119
            |.....|...|..|:|      ::.:   |..:.:|        .||      .||||:|||.||
  Fly    93 VYGYNPTYLRVITGTV------EYEKPDAVYFVEEHWIHCNYNSPDY------HNDIALIRLNDT 145

  Fly   120 LIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTM 184
            :.||...:|.:|..:..|.||:..::|||...:....|..|.|..:..:..:.|:..........
  Fly   146 IKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNG 210

  Fly   185 ICAAALL----KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            .|....|    :.:|||||||||...|.|.|:|::|..||.. .|..:|||.....||.:.|
  Fly   211 PCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCALG-VPDSHANVYYYLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 71/231 (31%)
Tryp_SPc 24..238 CDD:238113 70/230 (30%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/231 (31%)
Tryp_SPc 50..269 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.