DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG17477

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:223 Identity:68/223 - (30%)
Similarity:107/223 - (47%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IVGGHPVLISEVPWQAALM-YSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGG 87
            ||||......:.|:|.:|. ....::||..|.||:.||||.|||:....:...|..|::.....|
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly    88 QHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSA-PAAGTEASVSGWGEIG 151
            .......|..|.:| .|....|||.::.|.:::.|||..:.::|..|. |...:|...:|||...
  Fly    92 AVYYPDAIYLHCNY-DSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQS 155

  Fly   152 ILWLQPTSLLKTSVKILDPNVCK---RSYQ--YITKTMICAAALLK-DSCHGDSGGPLVSGGQLV 210
            .....|:.|.:...:.|:...|:   .:|:  .:....|||..... .:||||||||||..|.||
  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLV 220

  Fly   211 GIVSYGIGCANPFFPGVYANVAELKPWI 238
            ||:::.:.||.. .|.::.|:...:.|:
  Fly   221 GILNFFVPCAQG-VPDIFMNIMYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 67/221 (30%)
Tryp_SPc 24..238 CDD:238113 67/221 (30%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/223 (30%)
Tryp_SPc 27..246 CDD:214473 67/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.