DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG16749

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:251 Identity:79/251 - (31%)
Similarity:118/251 - (47%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSS---PE--RIVGGHPVLISEVPWQAALMYSE-KYICGAVIYSDKIIITAAH 64
            |.|.....|.:||.|   |:  |:|.|....:.:.|:..::..|. .:.||..|.|.:.::||||
  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71

  Fly    65 CVERPFDTLYSVRVGSVWKNLGGQH-ARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFN-AEVR 127
            |.:....:..||:.|....|..|.: .||..|.:||||.......|||:::.:.:...|: ..|.
  Fly    72 CTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVA 136

  Fly   128 PIQLADSAPA-----AGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYIT--KTMI 185
            |::|.:.|.|     ||.|..:.|||.........::|.:..:|:.....|...:...|  :..|
  Fly   137 PVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHI 201

  Fly   186 CAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWI 238
            |.....  |..|.|||||||:..||.|||||:.| .|....:||||..|::...||
  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/227 (31%)
Tryp_SPc 24..238 CDD:238113 69/226 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/227 (31%)
Tryp_SPc 30..259 CDD:238113 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.