DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Try10

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:89/246 - (36%)
Similarity:128/246 - (52%) Gaps:18/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |.||.:.....| :..::||||:....:.||:|.:| .|..:.||..:.:::.:::||||    :
  Rat     7 LALVGAAVAFPA-ADDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINEQWVVSAAHC----Y 65

  Fly    71 DTLYSVRVGSVWKNL---GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLA 132
            .:...||:|....|:   ..|....|.|.||.:::..| |.|||.:|:|...:..|:.|..:.|.
  Rat    66 KSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFIRKT-LNNDIMLIKLSSPVKLNSRVATVALP 129

  Fly   133 DSAPAAGTEASVSGWG---EIGILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL-- 191
            .|...|||:..:||||   ..|:  .:|..|......:|....|:.||. .||..|:||..|.  
  Rat   130 SSCAPAGTQCLISGWGNTLSFGV--NEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGG 192

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            ||||.||||||:|..|:|.||||:|.|||.|..||||..|.....||.:.|
  Rat   193 KDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/223 (37%)
Tryp_SPc 24..238 CDD:238113 82/222 (37%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 82/223 (37%)
Tryp_SPc 24..242 CDD:238113 84/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.